PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 481955
Common NameARALYDRAFT_481955
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 85aa    MW: 10464 Da    PI: 9.2298
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
481955genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.82.2e-073574445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T++E++l+ +  ++ G + W++Iar++  gR + ++  +w 
           481955 35 MTEQEEDLIFRMYRLVGDR-WDLIARRVV-GREAMEIERYWI 74
                     7****************99.*********.*******99995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.4E-53179IPR001005SANT/Myb domain
CDDcd001673.55E-53473No hitNo description
PfamPF002492.2E-63574IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-83574IPR009057Homeodomain-like
SuperFamilySSF466891.12E-63674IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:2000039Biological Processregulation of trichome morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MDNTNRLRRL QGRKQPKFTH NSEEVCSMKW EFINMTEQEE DLIFRMYRLV GDRWDLIARR  60
VVGREAMEIE RYWIMRNSDF FSQK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1087771e-102DQ108777.1 Arabidopsis thaliana clone 22671 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881110.14e-57DNA binding protein
SwissprotD3GKW63e-51TCL1_ARATH; MYB-like transcription factor TCL1
TrEMBLD7LC525e-57D7LC52_ARALL; DNA binding protein
STRINGfgenesh2_kg.4__1015__AT2G30432.11e-56(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30432.12e-52MYB_related family protein